Skip to content
RAG Repo

Wikimedia Commons

Wikimedia Commons is the shared media library behind Wikipedia and its sister projects. It holds more than 100 million files: photographs, illustrations, diagrams, audio recordings, and video. Content on Commons may be used by anyone, anywhere, and for any purpose, subject to the specific licence on each file.

Every file carries structured metadata through Structured Data on Commons, which describes what a file shows, who created it, and how it is licensed in a machine-readable form. That makes it possible to query and filter the collection programmatically rather than scraping pages.

Licences vary by file: some are released under CC0 or are in the public domain, while others use CC BY-SA, a share-alike licence meaning any derivative you distribute must carry the same terms. Because the file content and its metadata can sit under different licences, check each file before you build on it, especially for commercial use.

mediaimagesfreely-licensedwikimediastructured-datapublic-domain

Related sources